Speakenglishwithtiffaniacademy.com Summary
Speakenglishwithtiffaniacademy.com was created 6 years ago. Receives approximately 9,420 unique visitors per month. Server is located in United States, IP address 104.21.57.68.
Website Info
Creation date | 2018-12-04 |
Expiration date | 2021-12-04 |
Registrar | NAMECHEAP INC |
Name servers |
|
IP address | 104.21.57.68 |
Server located | United States |
Host name | 104.21.57.68 |
Alexa Traffic Ranks
Global Rank | 1,647,140 |
Delta (90 Days) | 895,276 |
Most Popular In Country | n/a |
Country Rank | n/a |
Whois info
Domain name: speakenglishwithtiffaniacademy.com Registry Domain ID: 2339788521_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.namecheap.com Registrar URL: http://www.namecheap.com Updated Date: 2020-11-04T07:58:52.81Z Creation Date: 2018-12-04T11:15:30.00Z Registrar Registration Expiration Date: 2021-12-04T11:15:30.00Z Registrar: NAMECHEAP INC Registrar IANA ID: 1068 Registrar Abuse Contact Email: abuse@namecheap.com Registrar Abuse Contact Phone: +1.6613102107 Reseller: NAMECHEAP INC Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Registrant Name: Withheld for Privacy Purposes Registrant Organization: Privacy service provided by Withheld for Privacy ehf Registrant Street: Kalkofnsvegur 2 Registrant City: Reykjavik Registrant State/Province: Capital Region Registrant Postal Code: 101 Registrant Country: IS Registrant Phone: +354.4212434 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: 37f06bcb5fd94152b7b0da4da1d042e5.protect@withheldforprivacy.com Registry Admin ID: Admin Name: Withheld for Privacy Purposes Admin Organization: Privacy service provided by Withheld for Privacy ehf Admin Street: Kalkofnsvegur 2 Admin City: Reykjavik Admin State/Province: Capital Region Admin Postal Code: 101 Admin Country: IS Admin Phone: +354.4212434 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: 37f06bcb5fd94152b7b0da4da1d042e5.protect@withheldforprivacy.com Registry Tech ID: Tech Name: Withheld for Privacy Purposes Tech Organization: Privacy service provided by Withheld for Privacy ehf Tech Street: Kalkofnsvegur 2 Tech City: Reykjavik Tech State/Province: Capital Region Tech Postal Code: 101 Tech Country: IS Tech Phone: +354.4212434 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: 37f06bcb5fd94152b7b0da4da1d042e5.protect@withheldforprivacy.com Name Server: dilbert.ns.cloudflare.com Name Server: zara.ns.cloudflare.com DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ |
DNS Records
Host | Type | TTL | Data |
---|---|---|---|
speakenglishwithtiffaniacademy.com | A | 300 |
ip: 104.21.57.68 |
speakenglishwithtiffaniacademy.com | A | 300 |
ip: 172.67.189.99 |
speakenglishwithtiffaniacademy.com | MX | 300 |
pri: 10 target: eforward1.registrar-servers.com |
speakenglishwithtiffaniacademy.com | MX | 300 |
pri: 10 target: eforward2.registrar-servers.com |
speakenglishwithtiffaniacademy.com | MX | 300 |
pri: 10 target: eforward3.registrar-servers.com |
speakenglishwithtiffaniacademy.com | MX | 300 |
pri: 15 target: eforward4.registrar-servers.com |
speakenglishwithtiffaniacademy.com | MX | 300 |
pri: 20 target: eforward5.registrar-servers.com |
speakenglishwithtiffaniacademy.com | NS | 86400 |
target: dilbert.ns.cloudflare.com |
speakenglishwithtiffaniacademy.com | NS | 86400 |
target: zara.ns.cloudflare.com |
speakenglishwithtiffaniacademy.com | SOA | 3600 |
mname: dilbert.ns.cloudflare.com rname: dns.cloudflare.com serial: 2037740151 refresh: 10000 retry: 2400 expire: 604800 minimum-ttl: 3600 |
speakenglishwithtiffaniacademy.com | TXT | 300 |
txt: v=spf1 include:spf.efwd.registrar-servers.com ~all |
speakenglishwithtiffaniacademy.com | AAAA | 300 |
ipv6: 2606:4700:3031::ac43:bd63 |
speakenglishwithtiffaniacademy.com | AAAA | 300 |
ipv6: 2606:4700:3031::6815:3944 |
HTTP Headers
Date: Thu, 10 Dec 2020 11:00:35 GMT Content-Type: text/html; charset=utf-8 Transfer-Encoding: chunked Connection: keep-alive X-Fedora-School-Id: 76970 Cache-Control: max-age=0, private, must-revalidate Set-Cookie: ahoy_visitor=12ccec9d-07fd-4d18-a5cd-15f517b4e634; path=/; expires=Sat, 10 Dec 2022 11:00:35 GMT; secure Set-Cookie: ahoy_visit=e2312837-50ad-4917-b1ee-b3323e28da4e; path=/; expires=Thu, 10 Dec 2020 15:00:35 GMT; secure Set-Cookie: ahoy_track=true; path=/; secure Set-Cookie: _afid=12ccec9d-07fd-4d18-a5cd-15f517b4e634; domain=.speakenglishwithtiffaniacademy.com; path=/; expires=Fri, 10 Dec 2021 11:00:35 GMT; secure Set-Cookie: aid=12ccec9d-07fd-4d18-a5cd-15f517b4e634; domain=.speakenglishwithtiffaniacademy.com; path=/; expires=Fri, 10 Dec 2021 11:00:35 GMT; secure Set-Cookie: site_preview=logged_out; path=/; secure; HttpOnly Set-Cookie: _session_id=a929b016966cd0ea42b3fac8f0d16927; path=/; expires=Sat, 09 Jan 2021 11:00:35 GMT; HttpOnly; secure X-Request-Id: c974d4eb-dbb8-4dd6-ae53-f21666d7b6fa X-Runtime: 0.074121 Vary: Accept-Encoding Strict-Transport-Security: max-age=0 X-Frame-Options: SAMEORIGIN X-Content-Type-Options: nosniff X-XSS-Protection: 1; mode=block X-Download-Options: noopen X-Permitted-Cross-Domain-Policies: none Referrer-Policy: no-referrer-when-downgrade CF-Cache-Status: DYNAMIC cf-request-id: 06ede868b200007f94428c1000000001 Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct" Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?s=FhAwlCzx6xMIvgALzzIvy61hKdRsE0TgXE3ca3%2FrKfzNcfvoiSWiU8tBqwH0ZjtGoYmgd2wSMXXzPe4O%2F0HHA%2FBDojcw4YxspAnYNI3u0ZcFh11VE5%2FibIjJ1puNVLJs4V3a"}],"group":"cf-nel","max_age":604800} NEL: {"report_to":"cf-nel","max_age":604800} Server: cloudflare CF-RAY: 5ff6768789357f94-ORD x-encoded-content-encoding: gzip |
Recently updated domains
- jaxarena.com
- realincest.org
- rootstockbar.com
- securenetprotect.com
- forexservices.best
- fifetowing.com
- josemanuelmedina.com
- bipark.ir
- cinemabomb.blogspot.com
- drone-insurance.com
- lflni-liban.net
- healthy-sporty-beautiful.com
- buildforce.ca
- irishvoip.com
- theferrellboysandme.blogspot.com
- concourmaroc.com
- retto.com
- profiten.club
- ariautm.com
- rockinghamlibrary.org
- kalenentp.com
- passaudiovideo.it
- shanbeshabha.blogfa.com
- rootability.com
- blogoro.it
- moisesdiazentrenador.com
- thinhnguyen.org
- pasok.eu
- ruwings.ru
- ergonomiewebshop.de