Kathrynleesmithwhitelineprints.com Summary
Kathrynleesmithwhitelineprints.com was created 16 years ago. Server is located in United States, IP address 206.188.192.57.
Website Info
Creation date | 2009-02-04 |
Expiration date | 2021-02-04 |
Registrar | Network Solutions, LLC |
Name servers |
|
IP address | 206.188.192.57 |
Server located | United States |
Host name | vux.netsolhost.com |
Alexa Traffic Ranks
Global Rank | n/a |
Delta (90 Days) | n/a |
Most Popular In Country | n/a |
Country Rank | n/a |
Whois info
Domain Name: KATHRYNLEESMITHWHITELINEPRINTS.COM Registry Domain ID: 1540860035_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.networksolutions.com Registrar URL: http://networksolutions.com Updated Date: 2019-10-23T16:30:35Z Creation Date: 2009-02-04T19:40:04Z Registry Expiry Date: 2021-02-04T19:40:04Z Registrar: Network Solutions, LLC Registrar IANA ID: 2 Registrar Abuse Contact Email: abuse@web.com Registrar Abuse Contact Phone: +1.8003337680 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: NS19.WORLDNIC.COM Name Server: NS20.WORLDNIC.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ |
DNS Records
Host | Type | TTL | Data |
---|---|---|---|
kathrynleesmithwhitelineprints.com | A | 7200 |
ip: 206.188.192.57 |
kathrynleesmithwhitelineprints.com | MX | 7200 |
pri: 10 target: mx1.netsolmail.net |
kathrynleesmithwhitelineprints.com | NS | 7200 |
target: ns20.worldnic.com |
kathrynleesmithwhitelineprints.com | NS | 7200 |
target: ns19.worldnic.com |
kathrynleesmithwhitelineprints.com | SOA | 7200 |
mname: NS19.WORLDNIC.com rname: namehost.WORLDNIC.com serial: 117110722 refresh: 10800 retry: 3600 expire: 604800 minimum-ttl: 3600 |
kathrynleesmithwhitelineprints.com | TXT | 7200 |
txt: google-site-verification=dUNxXy2cN-oMmf6cYtMwYy_t18grxDvNBu-p5Js2yuo |
HTTP Headers
Server: openresty/1.17.8.2 Date: Sat, 28 Nov 2020 22:51:08 GMT Content-Type: text/html Transfer-Encoding: chunked Vary: Accept-Encoding Last-Modified: Fri, 17 Mar 2017 22:03:16 GMT ETag: W/"335c-54af458420c56" X-Content-Type-Options: nosniff X-Frame-Options: SAMEORIGIN X-XSS-Protection: "1; mode=block" Referrer-Policy: no-referrer-when-downgrade X-Webcom-Cache-Status: BYPASS Connection: Close Proxy-Connection: Close x-encoded-content-encoding: gzip |
Recently updated domains
- jaxarena.com
- realincest.org
- rootstockbar.com
- securenetprotect.com
- forexservices.best
- fifetowing.com
- josemanuelmedina.com
- bipark.ir
- cinemabomb.blogspot.com
- drone-insurance.com
- lflni-liban.net
- healthy-sporty-beautiful.com
- buildforce.ca
- irishvoip.com
- theferrellboysandme.blogspot.com
- concourmaroc.com
- retto.com
- profiten.club
- ariautm.com
- rockinghamlibrary.org
- kalenentp.com
- passaudiovideo.it
- shanbeshabha.blogfa.com
- rootability.com
- blogoro.it
- moisesdiazentrenador.com
- thinhnguyen.org
- pasok.eu
- ruwings.ru
- ergonomiewebshop.de